{"title":"Snow Goggles and Lenses","description":null,"products":[{"product_id":"daily-carry-essential-sector-snow-goggle-high-sierra-green-mirror-for-snow-sports-equipment-transport-protection-and-winter-use-007","title":"Daily Carry Essential Sector Snow Goggle - High Sierra Green Mirror for Snow Sports Equipment Transport Protection and Winter Use","description":"Sector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\u003cp\u003eSay Hello to Sector. This large semi-frameless design provides maximum visibility and enhanced helmet integration for a smooth day on the mountain. Featuring a plant-based TPU frame fully recycled lens rim, our DK interLOCK lens swap system, cylindrical dual lens, and DK Aperture Optic lens with 5x anti-fog coating, this goggle maxes out on plant-based materials and performance.\u003c\/p\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Sector.jpg?v=1757524841\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle-Instructions_SECTOR.jpg?v=1757444225\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e31% THERMALPLASTIC POLYURTHANE, 22%POLYCARBONATE, 18% POLYESTER, 14% RECYCLED POLYCARBONATE, 14% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based SoftFlex frame, inner lens, and lens rim\u003c\/li\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based Sorona® strap and fleece face foam\u003c\/li\u003e \nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use. \n\u003cli\u003efully Recycled lens rim, QuickClip with dual strap adjustment, and strap overmold\u003c\/li\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled microfiber goggle pouch with inner lens sleeve\u003c\/li\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate toric dual lens for distortion-included optics and enhanced strength\u003c\/li\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eGOGGLE:\u003c\/li\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSeamless integration with Dakine helmets for elevated aesthetic, comfort, and ventilation\u003c\/li\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based TPU softFLEX frame comfortably conforms to your face, even in frigid temperatures\u003c\/li\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLarge semi-frameless design provides maximal visibility and enhanced helmet integration\u003c\/li\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOver the Glasses (OTG) compatibility for prescription eyewear\u003c\/li\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eTriple-layer foam with Plant-based Sorona® face fleece wicks moisture for all day comfort\u003c\/li\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eWide 45mm plant-based Sorona® strap for quality aesthetic and fit\u003c\/li\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET QuickClip with dual strap adjustment and dual silicone lining provides secure fit\u003c\/li\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eUpper and lower foam vents for balanced airflow\u003c\/li\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eINCLUDED\u003c\/li\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET microfiber goggle bag with inner lens sleeve\u003c\/li\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eSector Snow Goggle - High Sierra Green Mirror is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"High Sierra\/Green Mirror \/ OS","offer_id":64389890343281,"sku":"DK1200007","price":37.62,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/SECTORSNOWGOGGLE-HIGHSIERRA-194626596075_10004668_HIGHSIERRA-62M_MAIN.jpg?v=1786435475"},{"product_id":"active-equipment-sector-snow-goggle-black-black-for-snow-sports-equipment-transport-protection-and-winter-use-008","title":"Active Equipment Sector Snow Goggle - Black Black for Snow Sports Equipment Transport Protection and Winter Use","description":"Sector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\u003cp\u003eSay Hello to Sector. This large semi-frameless design provides maximum visibility and enhanced helmet integration for a smooth day on the mountain. Featuring a plant-based TPU frame fully recycled lens rim, our DK interLOCK lens swap system, cylindrical dual lens, and DK Aperture Optic lens with 5x anti-fog coating, this goggle maxes out on plant-based materials and performance.\u003c\/p\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Sector.jpg?v=1757524841\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle-Instructions_SECTOR.jpg?v=1757444225\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e31% THERMALPLASTIC POLYURTHANE, 22%POLYCARBONATE, 18% POLYESTER, 14% RECYCLED POLYCARBONATE, 14% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based SoftFlex frame, inner lens, and lens rim\u003c\/li\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based Sorona® strap and fleece face foam\u003c\/li\u003e \nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use. \n\u003cli\u003efully Recycled lens rim, QuickClip with dual strap adjustment, and strap overmold\u003c\/li\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled microfiber goggle pouch with inner lens sleeve\u003c\/li\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate toric dual lens for distortion-included optics and enhanced strength\u003c\/li\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eGOGGLE:\u003c\/li\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSeamless integration with Dakine helmets for elevated aesthetic, comfort, and ventilation\u003c\/li\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based TPU softFLEX frame comfortably conforms to your face, even in frigid temperatures\u003c\/li\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLarge semi-frameless design provides maximal visibility and enhanced helmet integration\u003c\/li\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOver the Glasses (OTG) compatibility for prescription eyewear\u003c\/li\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eTriple-layer foam with Plant-based Sorona® face fleece wicks moisture for all day comfort\u003c\/li\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eWide 45mm plant-based Sorona® strap for quality aesthetic and fit\u003c\/li\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET QuickClip with dual strap adjustment and dual silicone lining provides secure fit\u003c\/li\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eUpper and lower foam vents for balanced airflow\u003c\/li\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eINCLUDED\u003c\/li\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET microfiber goggle bag with inner lens sleeve\u003c\/li\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eSector Snow Goggle - Black Black is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Black\/Black \/ OS","offer_id":64389890376049,"sku":"DK1200008","price":43.56,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/SECTORSNOWGOGGLE-BLACK-194626596099_10004668_BLACK-62M_MAIN.jpg?v=1786435477"},{"product_id":"organized-outdoor-use-sector-snow-goggle-watercolor-drops-silver-mirror-for-snow-sports-equipment-transport-protection-and-winter-use-009","title":"Organized Outdoor Use Sector Snow Goggle - Watercolor Drops Silver Mirror for Snow Sports Equipment Transport Protection and Winter Use","description":"Sector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003cp\u003eSay Hello to Sector. This large semi-frameless design provides maximum visibility and enhanced helmet integration for a smooth day on the mountain. Featuring a plant-based TPU frame fully recycled lens rim, our DK interLOCK lens swap system, cylindrical dual lens, and DK Aperture Optic lens with 5x anti-fog coating, this goggle maxes out on plant-based materials and performance.\u003c\/p\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Sector.jpg?v=1757524841\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle-Instructions_SECTOR.jpg?v=1757444225\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e31% THERMALPLASTIC POLYURTHANE, 22%POLYCARBONATE, 18% POLYESTER, 14% RECYCLED POLYCARBONATE, 14% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based SoftFlex frame, inner lens, and lens rim\u003c\/li\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based Sorona® strap and fleece face foam\u003c\/li\u003e \nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use. \n\u003cli\u003efully Recycled lens rim, QuickClip with dual strap adjustment, and strap overmold\u003c\/li\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled microfiber goggle pouch with inner lens sleeve\u003c\/li\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate toric dual lens for distortion-included optics and enhanced strength\u003c\/li\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eGOGGLE:\u003c\/li\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSeamless integration with Dakine helmets for elevated aesthetic, comfort, and ventilation\u003c\/li\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based TPU softFLEX frame comfortably conforms to your face, even in frigid temperatures\u003c\/li\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLarge semi-frameless design provides maximal visibility and enhanced helmet integration\u003c\/li\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOver the Glasses (OTG) compatibility for prescription eyewear\u003c\/li\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eTriple-layer foam with Plant-based Sorona® face fleece wicks moisture for all day comfort\u003c\/li\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eWide 45mm plant-based Sorona® strap for quality aesthetic and fit\u003c\/li\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET QuickClip with dual strap adjustment and dual silicone lining provides secure fit\u003c\/li\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eUpper and lower foam vents for balanced airflow\u003c\/li\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eINCLUDED\u003c\/li\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET microfiber goggle bag with inner lens sleeve\u003c\/li\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eSector Snow Goggle - Watercolor Drops Silver Mirror is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Watercolor Drops\/Silver Mirror \/ OS","offer_id":64389890408817,"sku":"DK1200009","price":38.61,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/SECTORSNOWGOGGLE-WATERCOLORDROPS-194626596082_10004668_WTRCLRDRPS-62M_MAIN.jpg?v=1786435480"},{"product_id":"outdoor-adventure-sector-snow-goggle-dark-stargazer-rose-mirror-for-snow-sports-equipment-transport-protection-and-winter-use-010","title":"Outdoor Adventure Sector Snow Goggle - Dark Stargazer Rose Mirror for Snow Sports Equipment Transport Protection and Winter Use","description":"Sector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003cp\u003eSay Hello to Sector. This large semi-frameless design provides maximum visibility and enhanced helmet integration for a smooth day on the mountain. Featuring a plant-based TPU frame fully recycled lens rim, our DK interLOCK lens swap system, cylindrical dual lens, and DK Aperture Optic lens with 5x anti-fog coating, this goggle maxes out on plant-based materials and performance.\u003c\/p\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Sector.jpg?v=1757524841\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle-Instructions_SECTOR.jpg?v=1757444225\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e31% THERMALPLASTIC POLYURTHANE, 22%POLYCARBONATE, 18% POLYESTER, 14% RECYCLED POLYCARBONATE, 14% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based SoftFlex frame, inner lens, and lens rim\u003c\/li\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based Sorona® strap and fleece face foam\u003c\/li\u003e \nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use. \n\u003cli\u003efully Recycled lens rim, QuickClip with dual strap adjustment, and strap overmold\u003c\/li\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled microfiber goggle pouch with inner lens sleeve\u003c\/li\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate toric dual lens for distortion-included optics and enhanced strength\u003c\/li\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eGOGGLE:\u003c\/li\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSeamless integration with Dakine helmets for elevated aesthetic, comfort, and ventilation\u003c\/li\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based TPU softFLEX frame comfortably conforms to your face, even in frigid temperatures\u003c\/li\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLarge semi-frameless design provides maximal visibility and enhanced helmet integration\u003c\/li\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOver the Glasses (OTG) compatibility for prescription eyewear\u003c\/li\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eTriple-layer foam with Plant-based Sorona® face fleece wicks moisture for all day comfort\u003c\/li\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eWide 45mm plant-based Sorona® strap for quality aesthetic and fit\u003c\/li\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET QuickClip with dual strap adjustment and dual silicone lining provides secure fit\u003c\/li\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eUpper and lower foam vents for balanced airflow\u003c\/li\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eINCLUDED\u003c\/li\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET microfiber goggle bag with inner lens sleeve\u003c\/li\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eSector Snow Goggle - Dark Stargazer Rose Mirror is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Dark Stargazer\/Rose Mirror \/ OS","offer_id":64389890441585,"sku":"DK1200010","price":40.59,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/SECTORSNOWGOGGLE-DARKSTARGAZER-194626596068_10004668_DRKSTRGZER-62M_MAIN.jpg?v=1786435481"},{"product_id":"travel-ready-gear-venue-snow-goggle-black-amber-for-snow-sports-equipment-transport-protection-and-winter-use-011","title":"Travel Ready Gear Venue Snow Goggle - Black Amber for Snow Sports Equipment Transport Protection and Winter Use","description":"Venue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\u003cp\u003eThe fully Recycled TPU softFLEX frame conforms to your face, while the generous frame design provides enhanced on mountain visibility and helmet integration. The wide 45mm plant-based Sorona® strap with dual silicone lining, upper and lower foam vents, and fully recycled dual strap adjustment means the Venue delivers maximum comfort. Let's ride.\u003c\/p\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Venue.jpg?v=1757525155\"\u003eVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Report\u003c\/span\u003eVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\u003c\/a\u003eVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle-Instructions_VENUE.jpg?v=1757444228\"\u003eVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/span\u003eVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\u003c\/a\u003eVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e46% RECYCELED THERMALPLASTIC POLYURTHANE, 24% POLYCARBONATE, 20% POLYESTER, 10% RUBBER BAND\u003c\/li\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled frame\u003c\/li\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based inner lens\u003c\/li\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based Sorona® strap and fleece face foam\u003c\/li\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled dual strap adjustment and strap pin\u003c\/li\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled microfiber goggle pouch with inner lens sleeve\u003c\/li\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate toric dual lens for distortion-included optics and enhanced strength\u003c\/li\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eGOGGLE\u003c\/li\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSeamless integration with Dakine helmets for elevated aesthetic, comfort, and ventilation \u003c\/li\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based TPU softFLEX frame comfortably conforms to your face, even in frigid temperatures\u003c\/li\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLarge frame design for enhanced visibility and helmet integration\u003c\/li\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOver the Glasses (OTG) compatibility for prescription eyewear\u003c\/li\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eTriple-layer foam with Plant-based Sorona® face fleece wicks moisture for all day comfort\u003c\/li\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eWide 45mm plant-based Sorona® strap for quality aesthetic and fit\u003c\/li\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET QuickClip with dual strap adjustment and dual silicone lining provides secure fit\u003c\/li\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eUpper and lower foam vents for balanced airflow\u003c\/li\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eINCLUDED\u003c\/li\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET microfiber goggle bag with inner lens sleeve\u003c\/li\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eVenue Snow Goggle - Black Amber is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Black\/Amber \/ OS","offer_id":64389890474353,"sku":"DK1200011","price":33.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/VENUESNOWGOGGLE-BLACK-194626596020_10004670_BLACK-62M_MAIN.jpg?v=1786435483"},{"product_id":"daily-carry-essential-venue-snow-goggle-mulled-basil-amber-for-snow-sports-equipment-transport-protection-and-winter-use-012","title":"Daily Carry Essential Venue Snow Goggle - Mulled Basil Amber for Snow Sports Equipment Transport Protection and Winter Use","description":"Venue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\u003cp\u003eThe fully Recycled TPU softFLEX frame conforms to your face, while the generous frame design provides enhanced on mountain visibility and helmet integration. The wide 45mm plant-based Sorona® strap with dual silicone lining, upper and lower foam vents, and fully recycled dual strap adjustment means the Venue delivers maximum comfort. Let's ride.\u003c\/p\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Venue.jpg?v=1757525155\"\u003eVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Report\u003c\/span\u003eVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\u003c\/a\u003eVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle-Instructions_VENUE.jpg?v=1757444228\"\u003eVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/span\u003eVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\u003c\/a\u003eVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e46% RECYCELED THERMALPLASTIC POLYURTHANE, 24% POLYCARBONATE, 20% POLYESTER, 10% RUBBER BAND\u003c\/li\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled frame\u003c\/li\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based inner lens\u003c\/li\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based Sorona® strap and fleece face foam\u003c\/li\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled dual strap adjustment and strap pin\u003c\/li\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled microfiber goggle pouch with inner lens sleeve\u003c\/li\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate toric dual lens for distortion-included optics and enhanced strength\u003c\/li\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eGOGGLE\u003c\/li\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSeamless integration with Dakine helmets for elevated aesthetic, comfort, and ventilation \u003c\/li\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based TPU softFLEX frame comfortably conforms to your face, even in frigid temperatures\u003c\/li\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLarge frame design for enhanced visibility and helmet integration\u003c\/li\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOver the Glasses (OTG) compatibility for prescription eyewear\u003c\/li\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eTriple-layer foam with Plant-based Sorona® face fleece wicks moisture for all day comfort\u003c\/li\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eWide 45mm plant-based Sorona® strap for quality aesthetic and fit\u003c\/li\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET QuickClip with dual strap adjustment and dual silicone lining provides secure fit\u003c\/li\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eUpper and lower foam vents for balanced airflow\u003c\/li\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eINCLUDED\u003c\/li\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET microfiber goggle bag with inner lens sleeve\u003c\/li\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eVenue Snow Goggle - Mulled Basil Amber is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Mulled Basil\/Amber \/ OS","offer_id":64389890507121,"sku":"DK1200012","price":25.92,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/VENUESNOWGOGGLE-MULLEDBASIL-194626596013_10004670_MULLEDBASL-62M_MAIN.jpg?v=1786435485"},{"product_id":"active-equipment-venue-snow-goggle-white-amber-for-snow-sports-equipment-transport-protection-and-winter-use-013","title":"Active Equipment Venue Snow Goggle - White Amber for Snow Sports Equipment Transport Protection and Winter Use","description":"Venue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\u003cp\u003eThe fully Recycled TPU softFLEX frame conforms to your face, while the generous frame design provides enhanced on mountain visibility and helmet integration. The wide 45mm plant-based Sorona® strap with dual silicone lining, upper and lower foam vents, and fully recycled dual strap adjustment means the Venue delivers maximum comfort. Let's ride.\u003c\/p\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Venue.jpg?v=1757525155\"\u003eVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Report\u003c\/span\u003eVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\u003c\/a\u003eVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle-Instructions_VENUE.jpg?v=1757444228\"\u003eVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/span\u003eVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\u003c\/a\u003eVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e46% RECYCELED THERMALPLASTIC POLYURTHANE, 24% POLYCARBONATE, 20% POLYESTER, 10% RUBBER BAND\u003c\/li\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled frame\u003c\/li\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based inner lens\u003c\/li\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based Sorona® strap and fleece face foam\u003c\/li\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled dual strap adjustment and strap pin\u003c\/li\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled microfiber goggle pouch with inner lens sleeve\u003c\/li\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate toric dual lens for distortion-included optics and enhanced strength\u003c\/li\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eGOGGLE\u003c\/li\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSeamless integration with Dakine helmets for elevated aesthetic, comfort, and ventilation \u003c\/li\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based TPU softFLEX frame comfortably conforms to your face, even in frigid temperatures\u003c\/li\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLarge frame design for enhanced visibility and helmet integration\u003c\/li\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOver the Glasses (OTG) compatibility for prescription eyewear\u003c\/li\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eTriple-layer foam with Plant-based Sorona® face fleece wicks moisture for all day comfort\u003c\/li\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eWide 45mm plant-based Sorona® strap for quality aesthetic and fit\u003c\/li\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET QuickClip with dual strap adjustment and dual silicone lining provides secure fit\u003c\/li\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eUpper and lower foam vents for balanced airflow\u003c\/li\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eINCLUDED\u003c\/li\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET microfiber goggle bag with inner lens sleeve\u003c\/li\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eVenue Snow Goggle - White Amber is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"White\/Amber \/ OS","offer_id":64389890539889,"sku":"DK1200013","price":28.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/VENUESNOWGOGGLE-WHITE-194626596037_10004670_WHITE-62M_MAIN.jpg?v=1786435487"},{"product_id":"organized-outdoor-use-domain-snow-goggle-plus-white-black-plus-storm-rose-for-snow-sports-equipment-transport-protection-and-winter-use-014","title":"Organized Outdoor Use Domain Snow Goggle Plus - White Black Plus Storm Rose for Snow Sports Equipment Transport Protection and Winter Use","description":"Domain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\u003cp\u003eDominate the mountain in any conditions. DK Aperture Optics for amplified contrast and highlighted color details, plus DK magLOCK lens swap system for easy lens changes. This medium, plant-based, semi-framless design provides optimal visibility and superior helmet integration, while the plant-based lens, strap, and foam create a quality on mountain experience. The Domain goggle comes with an extra lens for low-light conditions. \u003c\/p\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Domain.jpg?v=1757524609\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle_Instructions_B-domain.jpg?v=1757444322\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e34% THERMALPLASTIC POLYURTHANE, 23% POLYCARBONATE, 15% POLYESTER, 14% RECYCLED POLYCARBONATE , 14% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based SoftFlex frame, inner lens, and lens rim\u003c\/li\u003e \nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use. \n\u003cli\u003ePlant-based Sorona® strap and fleece face foam\u003c\/li\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled QuickClip with dual strap adjustment\u003c\/li\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled microfiber goggle pouch with inner lens sleeve\u003c\/li\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate toric dual lens for distortion-included optics and enhanced strength\u003c\/li\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eGOGGLE\u003c\/li\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSeamless integration with Dakine helmets for elevated aesthetic, comfort, and ventilation\u003c\/li\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based TPU softFLEX frame comfortably conforms to your face, even in frigid temperatures\u003c\/li\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSemi-frameless design provides optimal visibility and superior helmet integration\u003c\/li\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOver the Glasses (OTG) compatibility for prescription eyewear\u003c\/li\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eTriple-layer foam with Plant-based Sorona® face fleece wicks moisture for all day comfort\u003c\/li\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eWide 45mm plant-based Sorona® strap for quality aesthetic and fit\u003c\/li\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET QuickClip with dual strap adjustment and dual silicone lining provides secure fit\u003c\/li\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eUpper and lower foam vents for balanced airflow\u003c\/li\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eINCLUDED\u003c\/li\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eTwo lenses: DK Aperture Optics lens, plus extra DK Aperture Optics storm lens for low-light conditions\u003c\/li\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET microfiber goggle bag with inner lens sleeve\u003c\/li\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eDomain Snow Goggle Plus - White Black Plus Storm Rose is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"White\/Black\/Plus Storm Rose \/ OS","offer_id":64389890638193,"sku":"DK1200014","price":59.85,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/DOMAINSNOWGOGGLEPLUS-WHITE-194626596006_10004666_WHITE-62M_MAIN.jpg?v=1786435489"},{"product_id":"outdoor-adventure-domain-snow-goggle-plus-castlerock-silver-mirror-plus-storm-rose-for-snow-sports-equipment-transport-protection-and-winter-use-015","title":"Outdoor Adventure Domain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose for Snow Sports Equipment Transport Protection and Winter Use","description":"Domain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\u003cp\u003eDominate the mountain in any conditions. DK Aperture Optics for amplified contrast and highlighted color details, plus DK magLOCK lens swap system for easy lens changes. This medium, plant-based, semi-framless design provides optimal visibility and superior helmet integration, while the plant-based lens, strap, and foam create a quality on mountain experience. The Domain goggle comes with an extra lens for low-light conditions. \u003c\/p\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Domain.jpg?v=1757524609\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle_Instructions_B-domain.jpg?v=1757444322\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e34% THERMALPLASTIC POLYURTHANE, 23% POLYCARBONATE, 15% POLYESTER, 14% RECYCLED POLYCARBONATE , 14% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based SoftFlex frame, inner lens, and lens rim\u003c\/li\u003e \nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use. \n\u003cli\u003ePlant-based Sorona® strap and fleece face foam\u003c\/li\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled QuickClip with dual strap adjustment\u003c\/li\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled microfiber goggle pouch with inner lens sleeve\u003c\/li\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate toric dual lens for distortion-included optics and enhanced strength\u003c\/li\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eGOGGLE\u003c\/li\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSeamless integration with Dakine helmets for elevated aesthetic, comfort, and ventilation\u003c\/li\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based TPU softFLEX frame comfortably conforms to your face, even in frigid temperatures\u003c\/li\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSemi-frameless design provides optimal visibility and superior helmet integration\u003c\/li\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOver the Glasses (OTG) compatibility for prescription eyewear\u003c\/li\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eTriple-layer foam with Plant-based Sorona® face fleece wicks moisture for all day comfort\u003c\/li\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eWide 45mm plant-based Sorona® strap for quality aesthetic and fit\u003c\/li\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET QuickClip with dual strap adjustment and dual silicone lining provides secure fit\u003c\/li\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eUpper and lower foam vents for balanced airflow\u003c\/li\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eINCLUDED\u003c\/li\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eTwo lenses: DK Aperture Optics lens, plus extra DK Aperture Optics storm lens for low-light conditions\u003c\/li\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET microfiber goggle bag with inner lens sleeve\u003c\/li\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eDomain Snow Goggle Plus - Castlerock Silver Mirror Plus Storm Rose is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Castlerock\/Silver Mirror\/Plus Storm Rose \/ OS","offer_id":64389890670961,"sku":"DK1200015","price":59.85,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/DOMAINSNOWGOGGLEPLUS-CASTLEROCK-194626595986_10004666_CASTLEROCK-62M_MAIN.jpg?v=1786435491"},{"product_id":"travel-ready-gear-domain-snow-goggle-plus-kingdom-black-silver-rose-for-snow-sports-equipment-transport-protection-and-winter-use-016","title":"Travel Ready Gear Domain Snow Goggle Plus - Kingdom Black Silver Rose for Snow Sports Equipment Transport Protection and Winter Use","description":"Domain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\u003cp\u003eDominate the mountain in any conditions. DK Aperture Optics for amplified contrast and highlighted color details, plus DK magLOCK lens swap system for easy lens changes. This medium, plant-based, semi-framless design provides optimal visibility and superior helmet integration, while the plant-based lens, strap, and foam create a quality on mountain experience. The Domain goggle comes with an extra lens for low-light conditions. \u003c\/p\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Domain.jpg?v=1757524609\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle_Instructions_B-domain.jpg?v=1757444322\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e34% THERMALPLASTIC POLYURTHANE, 23% POLYCARBONATE, 15% POLYESTER, 14% RECYCLED POLYCARBONATE , 14% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based SoftFlex frame, inner lens, and lens rim\u003c\/li\u003e \nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use. \n\u003cli\u003ePlant-based Sorona® strap and fleece face foam\u003c\/li\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled QuickClip with dual strap adjustment\u003c\/li\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled microfiber goggle pouch with inner lens sleeve\u003c\/li\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate toric dual lens for distortion-included optics and enhanced strength\u003c\/li\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eGOGGLE\u003c\/li\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSeamless integration with Dakine helmets for elevated aesthetic, comfort, and ventilation\u003c\/li\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based TPU softFLEX frame comfortably conforms to your face, even in frigid temperatures\u003c\/li\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSemi-frameless design provides optimal visibility and superior helmet integration\u003c\/li\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOver the Glasses (OTG) compatibility for prescription eyewear\u003c\/li\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eTriple-layer foam with Plant-based Sorona® face fleece wicks moisture for all day comfort\u003c\/li\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eWide 45mm plant-based Sorona® strap for quality aesthetic and fit\u003c\/li\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET QuickClip with dual strap adjustment and dual silicone lining provides secure fit\u003c\/li\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eUpper and lower foam vents for balanced airflow\u003c\/li\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eINCLUDED\u003c\/li\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eTwo lenses: DK Aperture Optics lens, plus extra DK Aperture Optics storm lens for low-light conditions\u003c\/li\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET microfiber goggle bag with inner lens sleeve\u003c\/li\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eDomain Snow Goggle Plus - Kingdom Black Silver Rose is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Kingdom Black\/Silver Mirror\/Plus Storm Rose \/ OS","offer_id":64389890703729,"sku":"DK1200016","price":64.98,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/DOMAINSNOWGOGGLEPLUS-KINGDOMBLACK-194626595979_10004666_KINGDOMBLK-62M_MAIN.jpg?v=1786435493"},{"product_id":"daily-carry-essential-domain-snow-goggle-plus-dark-stargazer-rose-yellow-for-snow-sports-equipment-transport-protection-and-winter-use-017","title":"Daily Carry Essential Domain Snow Goggle Plus - Dark Stargazer Rose Yellow for Snow Sports Equipment Transport Protection and Winter Use","description":"Domain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\u003cp\u003eDominate the mountain in any conditions. DK Aperture Optics for amplified contrast and highlighted color details, plus DK magLOCK lens swap system for easy lens changes. This medium, plant-based, semi-framless design provides optimal visibility and superior helmet integration, while the plant-based lens, strap, and foam create a quality on mountain experience. The Domain goggle comes with an extra lens for low-light conditions. \u003c\/p\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Domain.jpg?v=1757524609\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle_Instructions_B-domain.jpg?v=1757444322\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e34% THERMALPLASTIC POLYURTHANE, 23% POLYCARBONATE, 15% POLYESTER, 14% RECYCLED POLYCARBONATE , 14% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based SoftFlex frame, inner lens, and lens rim\u003c\/li\u003e \nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use. \n\u003cli\u003ePlant-based Sorona® strap and fleece face foam\u003c\/li\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled QuickClip with dual strap adjustment\u003c\/li\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled microfiber goggle pouch with inner lens sleeve\u003c\/li\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate toric dual lens for distortion-included optics and enhanced strength\u003c\/li\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eGOGGLE\u003c\/li\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSeamless integration with Dakine helmets for elevated aesthetic, comfort, and ventilation\u003c\/li\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based TPU softFLEX frame comfortably conforms to your face, even in frigid temperatures\u003c\/li\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSemi-frameless design provides optimal visibility and superior helmet integration\u003c\/li\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOver the Glasses (OTG) compatibility for prescription eyewear\u003c\/li\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eTriple-layer foam with Plant-based Sorona® face fleece wicks moisture for all day comfort\u003c\/li\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eWide 45mm plant-based Sorona® strap for quality aesthetic and fit\u003c\/li\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET QuickClip with dual strap adjustment and dual silicone lining provides secure fit\u003c\/li\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eUpper and lower foam vents for balanced airflow\u003c\/li\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eINCLUDED\u003c\/li\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eTwo lenses: DK Aperture Optics lens, plus extra DK Aperture Optics storm lens for low-light conditions\u003c\/li\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET microfiber goggle bag with inner lens sleeve\u003c\/li\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eDomain Snow Goggle Plus - Dark Stargazer Rose Yellow is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Dark Stargazer\/Rose Mirror\/Plus Storm Yellow \/ OS","offer_id":64389890736497,"sku":"DK1200017","price":61.56,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/DOMAINSNOWGOGGLEPLUS-DARKSTARGAZER-194626595993_10004666_DRKSTRGZER-62M_MAIN.jpg?v=1786435494"},{"product_id":"active-equipment-sector-snow-goggle-kingdom-black-tonal-silver-mirror-for-snow-sports-equipment-transport-protection-and-winter-use-018","title":"Active Equipment Sector Snow Goggle - Kingdom Black Tonal Silver Mirror for Snow Sports Equipment Transport Protection and Winter Use","description":"Sector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003cp\u003eSay Hello to Sector. This large semi-frameless design provides maximum visibility and enhanced helmet integration for a smooth day on the mountain. Featuring a plant-based TPU frame fully recycled lens rim, our DK interLOCK lens swap system, cylindrical dual lens, and DK Aperture Optic lens with 5x anti-fog coating, this goggle maxes out on plant-based materials and performance.\u003c\/p\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Sector.jpg?v=1757524841\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle-Instructions_SECTOR.jpg?v=1757444225\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e31% THERMALPLASTIC POLYURTHANE, 22%POLYCARBONATE, 18% POLYESTER, 14% RECYCLED POLYCARBONATE, 14% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based SoftFlex frame, inner lens, and lens rim\u003c\/li\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based Sorona® strap and fleece face foam\u003c\/li\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled lens rim, QuickClip with dual strap adjustment, and strap overmold\u003c\/li\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled microfiber goggle pouch with inner lens sleeve\u003c\/li\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate toric dual lens for distortion-included optics and enhanced strength\u003c\/li\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eGOGGLE:\u003c\/li\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSeamless integration with Dakine helmets for elevated aesthetic, comfort, and ventilation\u003c\/li\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based TPU softFLEX frame comfortably conforms to your face, even in frigid temperatures\u003c\/li\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLarge semi-frameless design provides maximal visibility and enhanced helmet integration\u003c\/li\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOver the Glasses (OTG) compatibility for prescription eyewear\u003c\/li\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eTriple-layer foam with Plant-based Sorona® face fleece wicks moisture for all day comfort\u003c\/li\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eWide 45mm plant-based Sorona® strap for quality aesthetic and fit\u003c\/li\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET QuickClip with dual strap adjustment and dual silicone lining provides secure fit\u003c\/li\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eUpper and lower foam vents for balanced airflow\u003c\/li\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eINCLUDED\u003c\/li\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET microfiber goggle bag with inner lens sleeve\u003c\/li\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eSector Snow Goggle - Kingdom Black Tonal Silver Mirror is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Kingdom Black Tonal\/Silver Mirror \/ OS","offer_id":64389890769265,"sku":"DK1200018","price":35.64,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/SECTORSNOWGOGGLE-KINGDOMBLACKTONAL-194626596051_10004668_KNGDMBLKTN-62M_MAIN.jpg?v=1786435496"},{"product_id":"organized-outdoor-use-sector-snow-goggle-castlerock-silver-mirror-for-snow-sports-equipment-transport-protection-and-winter-use-019","title":"Organized Outdoor Use Sector Snow Goggle - Castlerock Silver Mirror for Snow Sports Equipment Transport Protection and Winter Use","description":"Sector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003cp\u003eSay Hello to Sector. This large semi-frameless design provides maximum visibility and enhanced helmet integration for a smooth day on the mountain. Featuring a plant-based TPU frame fully recycled lens rim, our DK interLOCK lens swap system, cylindrical dual lens, and DK Aperture Optic lens with 5x anti-fog coating, this goggle maxes out on plant-based materials and performance.\u003c\/p\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Sector.jpg?v=1757524841\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle-Instructions_SECTOR.jpg?v=1757444225\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e31% THERMALPLASTIC POLYURTHANE, 22%POLYCARBONATE, 18% POLYESTER, 14% RECYCLED POLYCARBONATE, 14% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based SoftFlex frame, inner lens, and lens rim\u003c\/li\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based Sorona® strap and fleece face foam\u003c\/li\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled lens rim, QuickClip with dual strap adjustment, and strap overmold\u003c\/li\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled microfiber goggle pouch with inner lens sleeve\u003c\/li\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate toric dual lens for distortion-included optics and enhanced strength\u003c\/li\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eGOGGLE:\u003c\/li\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSeamless integration with Dakine helmets for elevated aesthetic, comfort, and ventilation\u003c\/li\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based TPU softFLEX frame comfortably conforms to your face, even in frigid temperatures\u003c\/li\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLarge semi-frameless design provides maximal visibility and enhanced helmet integration\u003c\/li\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOver the Glasses (OTG) compatibility for prescription eyewear\u003c\/li\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eTriple-layer foam with Plant-based Sorona® face fleece wicks moisture for all day comfort\u003c\/li\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eWide 45mm plant-based Sorona® strap for quality aesthetic and fit\u003c\/li\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET QuickClip with dual strap adjustment and dual silicone lining provides secure fit\u003c\/li\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eUpper and lower foam vents for balanced airflow\u003c\/li\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eINCLUDED\u003c\/li\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET microfiber goggle bag with inner lens sleeve\u003c\/li\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eSector Snow Goggle - Castlerock Silver Mirror is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Castlerock\/Silver Mirror \/ OS","offer_id":64389890834801,"sku":"DK1200019","price":38.61,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/SECTORSNOWGOGGLE-CASTLEROCK-194626596044_10004668_CASTLEROCK-62M_MAIN.jpg?v=1786435498"},{"product_id":"outdoor-adventure-domain-snow-goggle-plus-black-black-storm-yellow-for-snow-sports-equipment-transport-protection-and-winter-use-020","title":"Outdoor Adventure Domain Snow Goggle Plus - Black Black Storm Yellow for Snow Sports Equipment Transport Protection and Winter Use","description":"Domain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003cp\u003eDominate the mountain in any conditions. DK Aperture Optics for amplified contrast and highlighted color details, plus DK magLOCK lens swap system for easy lens changes. This medium, plant-based, semi-framless design provides optimal visibility and superior helmet integration, while the plant-based lens, strap, and foam create a quality on mountain experience. The Domain goggle comes with an extra lens for low-light conditions. \u003c\/p\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Domain.jpg?v=1757524609\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle_Instructions_B-domain.jpg?v=1757444322\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e34% THERMALPLASTIC POLYURTHANE, 23% POLYCARBONATE, 15% POLYESTER, 14% RECYCLED POLYCARBONATE , 14% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based SoftFlex frame, inner lens, and lens rim\u003c\/li\u003e \nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use. \n\u003cli\u003ePlant-based Sorona® strap and fleece face foam\u003c\/li\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled QuickClip with dual strap adjustment\u003c\/li\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled microfiber goggle pouch with inner lens sleeve\u003c\/li\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate toric dual lens for distortion-included optics and enhanced strength\u003c\/li\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eGOGGLE\u003c\/li\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSeamless integration with Dakine helmets for elevated aesthetic, comfort, and ventilation\u003c\/li\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based TPU softFLEX frame comfortably conforms to your face, even in frigid temperatures\u003c\/li\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSemi-frameless design provides optimal visibility and superior helmet integration\u003c\/li\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOver the Glasses (OTG) compatibility for prescription eyewear\u003c\/li\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eTriple-layer foam with Plant-based Sorona® face fleece wicks moisture for all day comfort\u003c\/li\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eWide 45mm plant-based Sorona® strap for quality aesthetic and fit\u003c\/li\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET QuickClip with dual strap adjustment and dual silicone lining provides secure fit\u003c\/li\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eUpper and lower foam vents for balanced airflow\u003c\/li\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eINCLUDED\u003c\/li\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eTwo lenses: DK Aperture Optics lens, plus extra DK Aperture Optics storm lens for low-light conditions\u003c\/li\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET microfiber goggle bag with inner lens sleeve\u003c\/li\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eDomain Snow Goggle Plus - Black Black Storm Yellow is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Black\/Black\/Plus Storm Yellow \/ OS","offer_id":64389890867569,"sku":"DK1200020","price":70.11,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/DOMAINSNOWGOGGLEPLUS-BLACK-194626595931_10004666_BLACK-62M_MAIN.jpg?v=1786435500"},{"product_id":"travel-ready-gear-domain-snow-goggle-plus-rain-drops-blue-mirror-plus-storm-yellow-for-snow-sports-equipment-transport-protection-and-winter-use-021","title":"Travel Ready Gear Domain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow for Snow Sports Equipment Transport Protection and Winter Use","description":"Domain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003cp\u003eDominate the mountain in any conditions. DK Aperture Optics for amplified contrast and highlighted color details, plus DK magLOCK lens swap system for easy lens changes. This medium, plant-based, semi-framless design provides optimal visibility and superior helmet integration, while the plant-based lens, strap, and foam create a quality on mountain experience. The Domain goggle comes with an extra lens for low-light conditions. \u003c\/p\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Domain.jpg?v=1757524609\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle_Instructions_B-domain.jpg?v=1757444322\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e34% THERMALPLASTIC POLYURTHANE, 23% POLYCARBONATE, 15% POLYESTER, 14% RECYCLED POLYCARBONATE , 14% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based SoftFlex frame, inner lens, and lens rim\u003c\/li\u003e \nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use. \n\u003cli\u003ePlant-based Sorona® strap and fleece face foam\u003c\/li\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled QuickClip with dual strap adjustment\u003c\/li\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled microfiber goggle pouch with inner lens sleeve\u003c\/li\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate toric dual lens for distortion-included optics and enhanced strength\u003c\/li\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eGOGGLE\u003c\/li\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSeamless integration with Dakine helmets for elevated aesthetic, comfort, and ventilation\u003c\/li\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based TPU softFLEX frame comfortably conforms to your face, even in frigid temperatures\u003c\/li\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSemi-frameless design provides optimal visibility and superior helmet integration\u003c\/li\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOver the Glasses (OTG) compatibility for prescription eyewear\u003c\/li\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eTriple-layer foam with Plant-based Sorona® face fleece wicks moisture for all day comfort\u003c\/li\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eWide 45mm plant-based Sorona® strap for quality aesthetic and fit\u003c\/li\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET QuickClip with dual strap adjustment and dual silicone lining provides secure fit\u003c\/li\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eUpper and lower foam vents for balanced airflow\u003c\/li\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eINCLUDED\u003c\/li\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eTwo lenses: DK Aperture Optics lens, plus extra DK Aperture Optics storm lens for low-light conditions\u003c\/li\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET microfiber goggle bag with inner lens sleeve\u003c\/li\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eDomain Snow Goggle Plus - Rain Drops Blue Mirror Plus Storm Yellow is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Rain Drops\/Blue Mirror\/Plus Storm Yellow \/ OS","offer_id":64389890900337,"sku":"DK1200021","price":75.24,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/DOMAINSNOWGOGGLEPLUS-RAINDROPS-194626595962_10004666_RAINDROPS-62M_MAIN.jpg?v=1786435502"},{"product_id":"travel-ready-gear-goggle-stash-mulled-basil-for-snow-sports-equipment-transport-protection-and-winter-use-226","title":"Travel Ready Gear Goggle Stash - Mulled Basil for Snow Sports Equipment Transport Protection and Winter Use","description":"Goggle Stash - Mulled Basil is intended for snow sports equipment transport protection and winter use.\u003ch3\u003eA padded goggle case with extra storage\u003c\/h3\u003e\nGoggle Stash - Mulled Basil is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eClean, dry goggles make for great riding. Give your goggles the respect they deserve between days at the hill with this goggle case. It's big enough to handle large frameless styles and features a built-in pouch to add moisture-absorbing desiccant pouches to expedite drying after a day of storm riding.\u003c\/p\u003e\nGoggle Stash - Mulled Basil is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Stash - Mulled Basil is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Stash - Mulled Basil is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eBODY: fully RECYCLED POLYESTER\u003c\/li\u003e\nGoggle Stash - Mulled Basil is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLINING: fully POLYESTER\u003c\/li\u003e\nGoggle Stash - Mulled Basil is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nGoggle Stash - Mulled Basil is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Stash - Mulled Basil is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Stash - Mulled Basil is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e9.44 x 6.69 x 4.72in [ 24 x 17 x 12cm ]\u003c\/li\u003e\nGoggle Stash - Mulled Basil is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e0.55 lbs [ 0.25 kgs ]\u003c\/li\u003e\nGoggle Stash - Mulled Basil is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nGoggle Stash - Mulled Basil is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Stash - Mulled Basil is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nGoggle Stash - Mulled Basil is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Stash - Mulled Basil is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eStores 1 pair of goggles and 2 extra lenses\u003c\/li\u003e\nGoggle Stash - Mulled Basil is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e360° padded foam protection\u003c\/li\u003e\nGoggle Stash - Mulled Basil is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRemovable goggle wipe included\u003c\/li\u003e\nGoggle Stash - Mulled Basil is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully recycled polyester\u003c\/li\u003e\nGoggle Stash - Mulled Basil is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eGoggle Stash - Mulled Basil is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Mulled Basil \/ OS","offer_id":64389922423153,"sku":"DK1200295","price":13.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/GOGGLESTASH-MULLEDBASIL-194626594484_10004393_MULLEDBASL-62M_MAIN.jpg?v=1786435896"},{"product_id":"organized-outdoor-use-goggle-stash-black-for-snow-sports-equipment-transport-protection-and-winter-use-289","title":"Organized Outdoor Use Goggle Stash - Black for Snow Sports Equipment Transport Protection and Winter Use","description":"Goggle Stash - Black is intended for snow sports equipment transport protection and winter use.\u003ch3\u003eA padded goggle case with extra storage\u003c\/h3\u003e\nGoggle Stash - Black is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eClean, dry goggles make for great riding. Give your goggles the respect they deserve between days at the hill with this goggle case. It's big enough to handle large frameless styles and features a built-in pouch to add moisture-absorbing desiccant pouches to expedite drying after a day of storm riding.\u003c\/p\u003e\nGoggle Stash - Black is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Stash - Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Stash - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eBODY: fully RECYCLED POLYESTER\u003c\/li\u003e\nGoggle Stash - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLINING: fully POLYESTER\u003c\/li\u003e\nGoggle Stash - Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nGoggle Stash - Black is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Stash - Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Stash - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e9.44 x 6.69 x 4.72in [ 24 x 17 x 12cm ]\u003c\/li\u003e\nGoggle Stash - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e0.55 lbs [ 0.25 kgs ]\u003c\/li\u003e\nGoggle Stash - Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nGoggle Stash - Black is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Stash - Black is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nGoggle Stash - Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Stash - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eStores 1 pair of goggles and 2 extra lenses\u003c\/li\u003e\nGoggle Stash - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e360° padded foam protection\u003c\/li\u003e\nGoggle Stash - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRemovable goggle wipe included\u003c\/li\u003e\nGoggle Stash - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully recycled polyester\u003c\/li\u003e\nGoggle Stash - Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eGoggle Stash - Black is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Black \/ OS","offer_id":64389941821809,"sku":"DK1200391","price":13.2,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/GOGGLESTASH-BLACK-194626560120_10004393_BLACK-52M_MAIN.jpg?v=1786436022"},{"product_id":"travel-ready-gear-domain-snow-goggle-replacement-lens-black-for-snow-sports-equipment-transport-protection-and-winter-use-496","title":"Travel Ready Gear Domain Snow Goggle Replacement Lens - Black for Snow Sports Equipment Transport Protection and Winter Use","description":"Domain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003cp\u003eDomain Snow Goggle Replacement Lens - Black\u003c\/p\u003e\nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Domain.jpg?v=1757524609\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle_Instructions_B-domain.jpg?v=1757444322\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e59% POLYCARBONATE, 17% CELLULOSE ACETATE PROPIONATE, 12% RECYCLED POLYCARBONATE, 12% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based inner lens and lens rim\u003c\/li\u003e \nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use. \n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate toric dual lens for distortion-included optics and enhanced strength\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eDomain Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Black \/ OS","offer_id":64389969412465,"sku":"DK1200902","price":27.36,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/DOMAINSNOWGOGGLEREPLACEMENTLENS-BLACK-194626595795_10004667_BLACK-62M_MAIN.jpg?v=1786436444"},{"product_id":"daily-carry-essential-sector-snow-goggle-replacement-lens-silver-mirror-for-snow-sports-equipment-transport-protection-and-winter-use-497","title":"Daily Carry Essential Sector Snow Goggle Replacement Lens - Silver Mirror for Snow Sports Equipment Transport Protection and Winter Use","description":"Sector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003cp\u003eSector Snow Goggle Replacement Lens - Silver Mirror\u003c\/p\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Sector.jpg?v=1757524841\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle-Instructions_SECTOR.jpg?v=1757444225\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e55% POLYCARBONATE,18% CELLULOSE ACETATE PROPIONATE,13% RECYCLED POLYCARBONATE,13% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based inner lens \/ fully Recycled lens rim\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate cylindrical dual lens for enhanced optics and strength\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eSector Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Silver Mirror \/ OS","offer_id":64389969445233,"sku":"DK1200903","price":26.23,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/SECTORSNOWGOGGLEREPLACEMENTLENS-SILVERMIRROR-194626595917_10004669_SLVRMIRROR-62M_MAIN.jpg?v=1786436445"},{"product_id":"active-equipment-domain-snow-goggle-replacement-lens-green-mirror-for-snow-sports-equipment-transport-protection-and-winter-use-498","title":"Active Equipment Domain Snow Goggle Replacement Lens - Green Mirror for Snow Sports Equipment Transport Protection and Winter Use","description":"Domain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\u003cp\u003eDomain Snow Goggle Replacement Lens - Green Mirror\u003c\/p\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Domain.jpg?v=1757524609\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle_Instructions_B-domain.jpg?v=1757444322\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e59% POLYCARBONATE, 17% CELLULOSE ACETATE PROPIONATE, 12% RECYCLED POLYCARBONATE, 12% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based inner lens and lens rim\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate toric dual lens for distortion-included optics and enhanced strength\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eDomain Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Green Mirror \/ OS","offer_id":64389969478001,"sku":"DK1200904","price":25.92,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/DOMAINSNOWGOGGLEREPLACEMENTLENS-GREENMIRROR-194626595955_10004667_GRENMIRROR-62M_MAIN.jpg?v=1786436448"},{"product_id":"organized-outdoor-use-sector-snow-goggle-replacement-lens-green-mirror-for-snow-sports-equipment-transport-protection-and-winter-use-499","title":"Organized Outdoor Use Sector Snow Goggle Replacement Lens - Green Mirror for Snow Sports Equipment Transport Protection and Winter Use","description":"Sector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\u003cp\u003eSector Snow Goggle Replacement Lens - Green Mirror\u003c\/p\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Sector.jpg?v=1757524841\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle-Instructions_SECTOR.jpg?v=1757444225\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e55% POLYCARBONATE,18% CELLULOSE ACETATE PROPIONATE,13% RECYCLED POLYCARBONATE,13% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based inner lens \/ fully Recycled lens rim\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate cylindrical dual lens for enhanced optics and strength\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eSector Snow Goggle Replacement Lens - Green Mirror is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Green Mirror \/ OS","offer_id":64389969543537,"sku":"DK1200905","price":23.18,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/SECTORSNOWGOGGLEREPLACEMENTLENS-GREENMIRROR-194626595900_10004669_GRENMIRROR-62M_MAIN.jpg?v=1786436449"},{"product_id":"outdoor-adventure-sector-snow-goggle-rei-co-op-mosaic-ridge-midnight-navy-green-mirror-for-snow-sports-equipment-transport-protection-and-winter-use-535","title":"Outdoor Adventure Sector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror for Snow Sports Equipment Transport Protection and Winter Use","description":"Sector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\u003cp\u003eSay Hello to Sector. This large semi-frameless design provides maximum visibility and enhanced helmet integration for a smooth day on the mountain. Featuring a plant-based TPU frame fully recycled lens rim, our DK interLOCK lens swap system, cylindrical dual lens, and DK Aperture Optic lens with 5x anti-fog coating, this goggle maxes out on plant-based materials and performance.\u003c\/p\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Sector.jpg?v=1757524841\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle-Instructions_SECTOR.jpg?v=1757444225\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e31% THERMALPLASTIC POLYURTHANE, 22%POLYCARBONATE, 18% POLYESTER, 14% RECYCLED POLYCARBONATE, 14% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based SoftFlex frame, inner lens, and lens rim\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based Sorona® strap and fleece face foam\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled lens rim, QuickClip with dual strap adjustment, and strap overmold\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled microfiber goggle pouch with inner lens sleeve\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate toric dual lens for distortion-included optics and enhanced strength\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eGOGGLE:\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSeamless integration with Dakine helmets for elevated aesthetic, comfort, and ventilation\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based TPU softFLEX frame comfortably conforms to your face, even in frigid temperatures\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLarge semi-frameless design provides maximal visibility and enhanced helmet integration\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOver the Glasses (OTG) compatibility for prescription eyewear\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eTriple-layer foam with Plant-based Sorona® face fleece wicks moisture for all day comfort\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eWide 45mm plant-based Sorona® strap for quality aesthetic and fit\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET QuickClip with dual strap adjustment and dual silicone lining provides secure fit\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eUpper and lower foam vents for balanced airflow\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eINCLUDED\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET microfiber goggle bag with inner lens sleeve\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eSector Snow Goggle + REI Co-Op - Mosaic Ridge Midnight Navy Green Mirror is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Mosaic Ridge Midnight Navy \/ Green Mirror \/ OS","offer_id":64389972033905,"sku":"DK1200969","price":34.65,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/SECTORSNOWGOGGLEPLUSREICOOP-MIDNIGHTWAVEMIDNIGHTNAVYGREENMIRROR-194626596181_10004725_MDTWMDTNVY-62M_MAIN_35d21ff8-270c-427d-942a-a751ff6da56c.jpg?v=1786436518"},{"product_id":"active-equipment-sector-snow-goggle-rei-co-op-midnight-wave-midnight-navy-silver-mirror-for-snow-sports-equipment-transport-protection-and-winter-use-538","title":"Active Equipment Sector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror for Snow Sports Equipment Transport Protection and Winter Use","description":"Sector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003cp\u003eSay Hello to Sector. This large semi-frameless design provides maximum visibility and enhanced helmet integration for a smooth day on the mountain. Featuring a plant-based TPU frame fully recycled lens rim, our DK interLOCK lens swap system, cylindrical dual lens, and DK Aperture Optic lens with 5x anti-fog coating, this goggle maxes out on plant-based materials and performance.\u003c\/p\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Sector.jpg?v=1757524841\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle-Instructions_SECTOR.jpg?v=1757444225\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e31% THERMALPLASTIC POLYURTHANE, 22%POLYCARBONATE, 18% POLYESTER, 14% RECYCLED POLYCARBONATE, 14% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based SoftFlex frame, inner lens, and lens rim\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based Sorona® strap and fleece face foam\u003c\/li\u003e \nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use. \n\u003cli\u003efully Recycled lens rim, QuickClip with dual strap adjustment, and strap overmold\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled microfiber goggle pouch with inner lens sleeve\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate toric dual lens for distortion-included optics and enhanced strength\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eGOGGLE:\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSeamless integration with Dakine helmets for elevated aesthetic, comfort, and ventilation\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based TPU softFLEX frame comfortably conforms to your face, even in frigid temperatures\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLarge semi-frameless design provides maximal visibility and enhanced helmet integration\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOver the Glasses (OTG) compatibility for prescription eyewear\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eTriple-layer foam with Plant-based Sorona® face fleece wicks moisture for all day comfort\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eWide 45mm plant-based Sorona® strap for quality aesthetic and fit\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET QuickClip with dual strap adjustment and dual silicone lining provides secure fit\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eUpper and lower foam vents for balanced airflow\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eINCLUDED\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled rPET microfiber goggle bag with inner lens sleeve\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eSector Snow Goggle + REI Co-Op - Midnight Wave Midnight Navy Silver Mirror is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Midnight Wave Midnight Navy \/ Silver Mirror \/ OS","offer_id":64389972263281,"sku":"DK1200976","price":39.6,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/SECTORSNOWGOGGLEPLUSREICOOP-MOSAICRIDGEMIDNIGHTNAVYSILVERMIRROR-194626596136_10004725_MRIDGEMNVY-62M_MAIN.jpg?v=1786436523"},{"product_id":"organized-outdoor-use-goggle-stash-high-sierra-for-snow-sports-equipment-transport-protection-and-winter-use-544","title":"Organized Outdoor Use Goggle Stash - High Sierra for Snow Sports Equipment Transport Protection and Winter Use","description":"Goggle Stash - High Sierra is intended for snow sports equipment transport protection and winter use.\u003ch3\u003eA padded goggle case with extra storage\u003c\/h3\u003e\nGoggle Stash - High Sierra is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eClean, dry goggles make for great riding. Give your goggles the respect they deserve between days at the hill with this goggle case. It's big enough to handle large frameless styles and features a built-in pouch to add moisture-absorbing desiccant pouches to expedite drying after a day of storm riding.\u003c\/p\u003e\nGoggle Stash - High Sierra is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Stash - High Sierra is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Stash - High Sierra is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eBODY: fully RECYCLED POLYESTER\u003c\/li\u003e\nGoggle Stash - High Sierra is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLINING: fully POLYESTER\u003c\/li\u003e\nGoggle Stash - High Sierra is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nGoggle Stash - High Sierra is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Stash - High Sierra is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Stash - High Sierra is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e9.44 x 6.69 x 4.72in [ 24 x 17 x 12cm ]\u003c\/li\u003e\nGoggle Stash - High Sierra is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e0.55 lbs [ 0.25 kgs ]\u003c\/li\u003e\nGoggle Stash - High Sierra is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nGoggle Stash - High Sierra is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Stash - High Sierra is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nGoggle Stash - High Sierra is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Stash - High Sierra is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eStores 1 pair of goggles and 2 extra lenses\u003c\/li\u003e\nGoggle Stash - High Sierra is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e360° padded foam protection\u003c\/li\u003e\nGoggle Stash - High Sierra is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRemovable goggle wipe included\u003c\/li\u003e\nGoggle Stash - High Sierra is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully recycled polyester\u003c\/li\u003e\nGoggle Stash - High Sierra is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eGoggle Stash - High Sierra is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"High Sierra \/ OS","offer_id":64389972558193,"sku":"DK1200985","price":11.7,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/GOGGLESTASH-HIGHSIERRA-194626594422_10004393_HIGHSIERRA-62M_MAIN.jpg?v=1786436533"},{"product_id":"outdoor-adventure-goggle-stash-ancient-water-for-snow-sports-equipment-transport-protection-and-winter-use-550","title":"Outdoor Adventure Goggle Stash - Ancient Water for Snow Sports Equipment Transport Protection and Winter Use","description":"Goggle Stash - Ancient Water is intended for snow sports equipment transport protection and winter use.\u003ch3\u003eA padded goggle case with extra storage\u003c\/h3\u003e\nGoggle Stash - Ancient Water is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eClean, dry goggles make for great riding. Give your goggles the respect they deserve between days at the hill with this goggle case. It's big enough to handle large frameless styles and features a built-in pouch to add moisture-absorbing desiccant pouches to expedite drying after a day of storm riding.\u003c\/p\u003e\nGoggle Stash - Ancient Water is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Stash - Ancient Water is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Stash - Ancient Water is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eBODY: fully RECYCLED POLYESTER\u003c\/li\u003e\nGoggle Stash - Ancient Water is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLINING: fully POLYESTER\u003c\/li\u003e\nGoggle Stash - Ancient Water is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nGoggle Stash - Ancient Water is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Stash - Ancient Water is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Stash - Ancient Water is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e9.44 x 6.69 x 4.72in [ 24 x 17 x 12cm ]\u003c\/li\u003e\nGoggle Stash - Ancient Water is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e0.55 lbs [ 0.25 kgs ]\u003c\/li\u003e\nGoggle Stash - Ancient Water is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nGoggle Stash - Ancient Water is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Stash - Ancient Water is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nGoggle Stash - Ancient Water is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Stash - Ancient Water is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eStores 1 pair of goggles and 2 extra lenses\u003c\/li\u003e\nGoggle Stash - Ancient Water is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e360° padded foam protection\u003c\/li\u003e\nGoggle Stash - Ancient Water is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRemovable goggle wipe included\u003c\/li\u003e\nGoggle Stash - Ancient Water is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully recycled polyester\u003c\/li\u003e\nGoggle Stash - Ancient Water is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eGoggle Stash - Ancient Water is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Ancient Water \/ OS","offer_id":64389972820337,"sku":"DK1200993","price":12.6,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/GOGGLESTASH-ANCIENTWATER-194626594491_10004393_ANCNTWATER-62M_MAIN.jpg?v=1786436544"},{"product_id":"travel-ready-gear-sector-snow-goggle-replacement-lens-storm-rose-for-snow-sports-equipment-transport-protection-and-winter-use-551","title":"Travel Ready Gear Sector Snow Goggle Replacement Lens - Storm Rose for Snow Sports Equipment Transport Protection and Winter Use","description":"Sector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\u003cp\u003eSector Snow Goggle Replacement Lens - Storm Rose\u003c\/p\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Sector.jpg?v=1757524841\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle-Instructions_SECTOR.jpg?v=1757444225\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e55% POLYCARBONATE,18% CELLULOSE ACETATE PROPIONATE,13% RECYCLED POLYCARBONATE,13% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based inner lens \/ fully Recycled lens rim\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate cylindrical dual lens for enhanced optics and strength\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eSector Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Storm Rose \/ OS","offer_id":64389973180785,"sku":"DK1200994","price":22.5,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/SECTORSNOWGOGGLEREPLACEMENTLENS-STORMROSE-194626596112_10004669_STORMROSE-62M_MAIN.jpg?v=1786436545"},{"product_id":"active-equipment-sector-snow-goggle-replacement-lens-rose-mirror-for-snow-sports-equipment-transport-protection-and-winter-use-558","title":"Active Equipment Sector Snow Goggle Replacement Lens - Rose Mirror for Snow Sports Equipment Transport Protection and Winter Use","description":"Sector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003cp\u003eSector Snow Goggle Replacement Lens - Rose Mirror\u003c\/p\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Sector.jpg?v=1757524841\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle-Instructions_SECTOR.jpg?v=1757444225\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e55% POLYCARBONATE,18% CELLULOSE ACETATE PROPIONATE,13% RECYCLED POLYCARBONATE,13% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based inner lens \/ fully Recycled lens rim\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate cylindrical dual lens for enhanced optics and strength\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eSector Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Rose Mirror \/ OS","offer_id":64389973803377,"sku":"DK1201011","price":23.79,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/SECTORSNOWGOGGLEREPLACEMENTLENS-ROSEMIRROR-194626595894_10004669_ROSEMIRROR-62M_MAIN.jpg?v=1786436558"},{"product_id":"active-equipment-sector-snow-goggle-replacement-lens-storm-yellow-for-snow-sports-equipment-transport-protection-and-winter-use-573","title":"Active Equipment Sector Snow Goggle Replacement Lens - Storm Yellow for Snow Sports Equipment Transport Protection and Winter Use","description":"Sector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003cp\u003eSector Snow Goggle Replacement Lens - Storm Yellow\u003c\/p\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Sector.jpg?v=1757524841\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle-Instructions_SECTOR.jpg?v=1757444225\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e55% POLYCARBONATE,18% CELLULOSE ACETATE PROPIONATE,13% RECYCLED POLYCARBONATE,13% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based inner lens \/ fully Recycled lens rim\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate cylindrical dual lens for enhanced optics and strength\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eSector Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Storm Yellow \/ OS","offer_id":64389974851953,"sku":"DK1201038","price":22.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/SECTORSNOWGOGGLEREPLACEMENTLENS-STORMYELLOW-194626595832_10004669_STRMYELLOW-62M_MAIN.jpg?v=1786436583"},{"product_id":"travel-ready-gear-goggle-stash-x-b4bc-b4bc-kingdom-for-snow-sports-equipment-transport-protection-and-winter-use-576","title":"Travel Ready Gear Goggle Stash X B4BC - B4BC Kingdom for Snow Sports Equipment Transport Protection and Winter Use","description":"Goggle Stash X B4BC - B4BC Kingdom is intended for snow sports equipment transport protection and winter use.\u003cp\u003eDesigned by artist and Dakine collaborator, Sarah King, the B4BC collection is our latest offering supporting Boarding for Breast Cancer, a 501©3 that raises money for cancer prevention. \u003c\/p\u003e\nGoggle Stash X B4BC - B4BC Kingdom is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDakine first teamed up with B4BC in 2019. Years later, our commitment to the fight continues and we are honored to create trusted equipment for an important cause.\u003c\/p\u003e\nGoggle Stash X B4BC - B4BC Kingdom is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Stash X B4BC - B4BC Kingdom is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Stash X B4BC - B4BC Kingdom is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eBODY: fully RECYCLED POLYESTER\u003c\/li\u003e\nGoggle Stash X B4BC - B4BC Kingdom is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLINING: fully POLYESTER\u003c\/li\u003e\nGoggle Stash X B4BC - B4BC Kingdom is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nGoggle Stash X B4BC - B4BC Kingdom is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Stash X B4BC - B4BC Kingdom is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Stash X B4BC - B4BC Kingdom is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e9.44 x 6.69 x 4.72in [ 24 x 17 x 12cm ] \u003c\/li\u003e\nGoggle Stash X B4BC - B4BC Kingdom is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e0.55 lbs [ 0.25 kgs] \u003c\/li\u003e\nGoggle Stash X B4BC - B4BC Kingdom is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nGoggle Stash X B4BC - B4BC Kingdom is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Stash X B4BC - B4BC Kingdom is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nGoggle Stash X B4BC - B4BC Kingdom is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Stash X B4BC - B4BC Kingdom is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDAKINE x BOARDING FOR BREAST CANCER\u003c\/li\u003e\nGoggle Stash X B4BC - B4BC Kingdom is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eStores 1 pair of goggles and 2 extra lenses\u003c\/li\u003e\nGoggle Stash X B4BC - B4BC Kingdom is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e360° padded foam protection\u003c\/li\u003e\nGoggle Stash X B4BC - B4BC Kingdom is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRemovable goggle wipe included\u003c\/li\u003e\nGoggle Stash X B4BC - B4BC Kingdom is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully recycled polyester\u003c\/li\u003e\nGoggle Stash X B4BC - B4BC Kingdom is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eGoggle Stash X B4BC - B4BC Kingdom is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"B4BC Kingdom \/ OS","offer_id":64389975146865,"sku":"DK1201047","price":12.96,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/GOGGLESTASHXB4BC-B4BCKINGDOM-194626594521_10004565_B4BCKINGDM-62M_MAIN.jpg?v=1786436588"},{"product_id":"travel-ready-gear-domain-snow-goggle-replacement-lens-storm-rose-for-snow-sports-equipment-transport-protection-and-winter-use-581","title":"Travel Ready Gear Domain Snow Goggle Replacement Lens - Storm Rose for Snow Sports Equipment Transport Protection and Winter Use","description":"Domain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\u003cp\u003eDomain Snow Goggle Replacement Lens - Storm Rose\u003c\/p\u003e\nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Domain.jpg?v=1757524609\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle_Instructions_B-domain.jpg?v=1757444322\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e59% POLYCARBONATE, 17% CELLULOSE ACETATE PROPIONATE, 12% RECYCLED POLYCARBONATE, 12% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based inner lens and lens rim\u003c\/li\u003e \nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use. \n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate toric dual lens for distortion-included optics and enhanced strength\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eDomain Snow Goggle Replacement Lens - Storm Rose is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Storm Rose \/ OS","offer_id":64389975540081,"sku":"DK1201058","price":23.18,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/DOMAINSNOWGOGGLEREPLACEMENTLENS-STORMROSE-194626596129_10004667_STORMROSE-62M_MAIN.jpg?v=1786436600"},{"product_id":"daily-carry-essential-domain-snow-goggle-replacement-lens-silver-mirror-for-snow-sports-equipment-transport-protection-and-winter-use-597","title":"Daily Carry Essential Domain Snow Goggle Replacement Lens - Silver Mirror for Snow Sports Equipment Transport Protection and Winter Use","description":"Domain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003cp\u003eDomain Snow Goggle Replacement Lens - Silver Mirror\u003c\/p\u003e\nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Domain.jpg?v=1757524609\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle_Instructions_B-domain.jpg?v=1757444322\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e59% POLYCARBONATE, 17% CELLULOSE ACETATE PROPIONATE, 12% RECYCLED POLYCARBONATE, 12% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based inner lens and lens rim\u003c\/li\u003e \nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use. \n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate toric dual lens for distortion-included optics and enhanced strength\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eDomain Snow Goggle Replacement Lens - Silver Mirror is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Silver Mirror \/ OS","offer_id":64389976654193,"sku":"DK1201092","price":31.68,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/DOMAINSNOWGOGGLEREPLACEMENTLENS-SILVERMIRROR-194626595870_10004667_SLVRMIRROR-62M_MAIN.jpg?v=1786436627"},{"product_id":"active-equipment-domain-snow-goggle-replacement-lens-rose-mirror-for-snow-sports-equipment-transport-protection-and-winter-use-603","title":"Active Equipment Domain Snow Goggle Replacement Lens - Rose Mirror for Snow Sports Equipment Transport Protection and Winter Use","description":"Domain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003cp\u003eDomain Snow Goggle Replacement Lens - Rose Mirror\u003c\/p\u003e\nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Domain.jpg?v=1757524609\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle_Instructions_B-domain.jpg?v=1757444322\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e59% POLYCARBONATE, 17% CELLULOSE ACETATE PROPIONATE, 12% RECYCLED POLYCARBONATE, 12% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based inner lens and lens rim\u003c\/li\u003e \nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use. \n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate toric dual lens for distortion-included optics and enhanced strength\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eDomain Snow Goggle Replacement Lens - Rose Mirror is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Rose Mirror \/ OS","offer_id":64389976949105,"sku":"DK1201101","price":31.68,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/DOMAINSNOWGOGGLEREPLACEMENTLENS-ROSEMIRROR-194626595924_10004667_ROSEMIRROR-62M_MAIN.jpg?v=1786436637"},{"product_id":"travel-ready-gear-sector-snow-goggle-replacement-lens-black-for-snow-sports-equipment-transport-protection-and-winter-use-606","title":"Travel Ready Gear Sector Snow Goggle Replacement Lens - Black for Snow Sports Equipment Transport Protection and Winter Use","description":"Sector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003cp\u003eSector Snow Goggle Replacement Lens - Black\u003c\/p\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Sector.jpg?v=1757524841\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle-Instructions_SECTOR.jpg?v=1757444225\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e55% POLYCARBONATE,18% CELLULOSE ACETATE PROPIONATE,13% RECYCLED POLYCARBONATE,13% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based inner lens \/ fully Recycled lens rim\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate cylindrical dual lens for enhanced optics and strength\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eSector Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Black \/ OS","offer_id":64389977178481,"sku":"DK1201108","price":21.35,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/SECTORSNOWGOGGLEREPLACEMENTLENS-BLACK-194626595856_10004669_BLACK-62M_MAIN.jpg?v=1786436642"},{"product_id":"outdoor-adventure-domain-snow-goggle-replacement-lens-storm-yellow-for-snow-sports-equipment-transport-protection-and-winter-use-610","title":"Outdoor Adventure Domain Snow Goggle Replacement Lens - Storm Yellow for Snow Sports Equipment Transport Protection and Winter Use","description":"Domain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003cp\u003eDomain Snow Goggle Replacement Lens - Storm Yellow\u003c\/p\u003e\nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Domain.jpg?v=1757524609\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle_Instructions_B-domain.jpg?v=1757444322\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e59% POLYCARBONATE, 17% CELLULOSE ACETATE PROPIONATE, 12% RECYCLED POLYCARBONATE, 12% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based inner lens and lens rim\u003c\/li\u003e \nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use. \n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate toric dual lens for distortion-included optics and enhanced strength\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eDomain Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Storm Yellow \/ OS","offer_id":64389977506161,"sku":"DK1201115","price":25.01,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/DOMAINSNOWGOGGLEREPLACEMENTLENS-STORMYELLOW-194626595801_10004667_STRMYELLOW-62M_MAIN.jpg?v=1786436652"},{"product_id":"active-equipment-domain-snow-goggle-replacement-lens-blue-mirror-for-snow-sports-equipment-transport-protection-and-winter-use-628","title":"Active Equipment Domain Snow Goggle Replacement Lens - Blue Mirror for Snow Sports Equipment Transport Protection and Winter Use","description":"Domain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\u003cp\u003eDomain Snow Goggle Replacement Lens - Blue Mirror\u003c\/p\u003e\nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Domain.jpg?v=1757524609\" style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Reports\u003c\/a\u003eDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle_Instructions_B-domain.jpg?v=1757444322\" style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/a\u003eDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/span\u003eDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e59% POLYCARBONATE, 17% CELLULOSE ACETATE PROPIONATE, 12% RECYCLED POLYCARBONATE, 12% RECYCLED ACRYLONITRILE BUTADIENE STYRENE\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based inner lens and lens rim\u003c\/li\u003e \nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use. \n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK magLOCK lens swap system with magnets for quick and easy lens changes\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate toric dual lens for distortion-included optics and enhanced strength\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eDomain Snow Goggle Replacement Lens - Blue Mirror is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Blue Mirror \/ OS","offer_id":64389978784113,"sku":"DK1201153","price":25.2,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/DOMAINSNOWGOGGLEREPLACEMENTLENS-BLUEMIRROR-194626595948_10004667_BLUEMIRROR-62M_MAIN.jpg?v=1786436689"},{"product_id":"organized-outdoor-use-venue-snow-goggle-replacement-lens-black-for-snow-sports-equipment-transport-protection-and-winter-use-639","title":"Organized Outdoor Use Venue Snow Goggle Replacement Lens - Black for Snow Sports Equipment Transport Protection and Winter Use","description":"Venue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003cp\u003eVenue Snow Goggle Replacement Lens - Black\u003c\/p\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Venue.jpg?v=1757525155\"\u003eVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Report\u003c\/span\u003eVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003c\/a\u003eVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle-Instructions_VENUE.jpg?v=1757444228\"\u003eVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/span\u003eVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003c\/a\u003eVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e68% POLYCARBONATE, 26% CELLULOSE ACETATE PROPIONATE, 6% ETHYLENE PROPYLENE DIENE MONOMER\u003c\/li\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled frame\u003c\/li\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based inner lens\u003c\/li\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details (Black and Storm Yellow Only)\u003c\/li\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate cylindrical dual lens\u003c\/li\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eVenue Snow Goggle Replacement Lens - Black is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Black \/ OS","offer_id":64389979734385,"sku":"DK1201180","price":15.84,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/VENUESNOWGOGGLEREPLACEMENTLENS-BLACK-194626595863_10004671_BLACK-62M_MAIN.jpg?v=1786436711"},{"product_id":"active-equipment-venue-snow-goggle-replacement-lens-storm-yellow-for-snow-sports-equipment-transport-protection-and-winter-use-648","title":"Active Equipment Venue Snow Goggle Replacement Lens - Storm Yellow for Snow Sports Equipment Transport Protection and Winter Use","description":"Venue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003cp\u003eVenue Snow Goggle Replacement Lens - Storm Yellow\u003c\/p\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/dk-jr286-w26-ISO_18527-12021_Venue.jpg?v=1757525155\"\u003eVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eCE Lab Test Report\u003c\/span\u003eVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003c\/a\u003eVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003ca href=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0242\/3141\/1792\/files\/DK-JR286-W26-SnowGoggle-Instructions_VENUE.jpg?v=1757444228\"\u003eVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003cspan style=\"color: rgb(43, 0, 255);\"\u003eLens Change Instructions\u003c\/span\u003eVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003c\/a\u003eVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\u003c\/p\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e68% POLYCARBONATE, 26% CELLULOSE ACETATE PROPIONATE, 6% ETHYLENE PROPYLENE DIENE MONOMER\u003c\/li\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRESPECTFUL PRODUCT MATERIALS\u003c\/li\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully Recycled frame\u003c\/li\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based inner lens\u003c\/li\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLENS\u003c\/li\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDK Aperture Optics lens for amplified contrast and highlighted color details (Black and Storm Yellow Only)\u003c\/li\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003equality injection molded hard-coated polycarbonate cylindrical dual lens\u003c\/li\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePlant-based acetate inner lens with 5x anti-fog coating for fog-included performance\u003c\/li\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMeets CE impact requirements based on ANSI Z87.1, EN 174, and ISO 18527-1\u003c\/li\u003e\nVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eVenue Snow Goggle Replacement Lens - Storm Yellow is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Storm Yellow \/ OS","offer_id":64389980684657,"sku":"DK1201203","price":18.04,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/VENUESNOWGOGGLEREPLACEMENTLENS-STORMYELLOW-194626595702_10004671_STRMYELLOW-62M_MAIN.jpg?v=1786436729"},{"product_id":"outdoor-adventure-goggle-stash-for-snow-sports-equipment-transport-protection-and-winter-use-965","title":"Outdoor Adventure Goggle Stash for Snow Sports Equipment Transport Protection and Winter Use","description":"Goggle Stash is intended for snow sports equipment transport protection and winter use.\u003ch3\u003eA padded goggle case with extra storage\u003c\/h3\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eClean, dry goggles make for great riding. Give your goggles the respect they deserve between days at the hill with this goggle case. It's big enough to handle large frameless styles and features a built-in pouch to add moisture-absorbing desiccant pouches to expedite drying after a day of storm riding.\u003c\/p\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\n  Goggle Stash is intended for snow sports equipment transport protection and winter use.\n  \u003cli\u003eBLACK: 600D Recycled Polyester ripstop with water repellent finish, bluesign® approved materials.\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eCASCADE CAMO: 600D Polyester with water repellent finish, bluesign® approved material\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eB4BC GRAPEVINE: 600D Polyester with water repellent finish, bluesign® approved material\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eBISON: 600D Polyester with water repellent finish, bluesign® approved material\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDEEP BLUE: 600D Polyester with water repellent finish, bluesign® approved material\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eDEEP LAKE: 600D Polyester with water repellent finish, bluesign® approved material\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMOLTEN LAVA: 600D Polyester with water repellent finish, bluesign® approved material\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSAND QUARTZ: 600D Polyester with water repellent finish, bluesign® approved material\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSTEEL GREY: 600D Polyester with water repellent finish, bluesign® approved material\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSTREET ART: 600D Polyester with water repellent finish, bluesign® approved material\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eWOODLAND FLORAL\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eB4BC FLORAL: 600D Recycled Polyester plain weave with print and water repellent finish, bluesign® approved materials.\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eBLUE GRAPHITE: 600D Recycled Polyester ripstop with water repellent finish, bluesign® approved materials.\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eCASCADE CAMO: 600D Recycled Polyester ripstop with print and water repellent finish, bluesign® approved materials.\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eGREYSCALE: 300D Polyester heather plain weave with water repellent finish \/ 400D nylon + Polyester heather plain weave with water repellent finish, bluesign® approved materials.\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003ePORT RED: 600D Recycled Polyester ripstop with water repellent finish, bluesign® approved materials.\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRED EARTH: 600D Recycled Polyester ripstop with water repellent finish, bluesign® approved materials.\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSOLSTICE FLORAL: 600D Recycled Polyester, Plain weave with print and water repellent finish, bluesign® approved material.\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSPARROW: 600D Recycled Polyester ripstop with water repellent finish, bluesign® approved materials.\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eSUN FLARE: 305D Cordura Polyester ripstop with water repellent finish, bluesign® approved materials.\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e9 x 5 x 5 [ 23 x 13 x 13cm ]\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e.5 lbs. [ .2kg ]\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e1 Year Limited Warranty\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eInterior zippered pocket|Adjustable cross body shoulder strap\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eFits large goggles and extra lenses\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eFully padded and fleece lined\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eMesh pocket\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eBuilt-in removable desiccant pouch keeps goggles dry\u003c\/li\u003e\nGoggle Stash is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eGoggle Stash is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"B4BC Grapevine \/ OS","offer_id":64390059786609,"sku":"DK1202272","price":9.75,"currency_code":"USD","in_stock":true},{"title":"Mustard Seed \/ OS","offer_id":64390059819377,"sku":"DK1202273","price":11.0,"currency_code":"USD","in_stock":true},{"title":"Utility Green \/ OS","offer_id":64390059852145,"sku":"DK1202274","price":10.5,"currency_code":"USD","in_stock":true},{"title":"Vintage Camo \/ OS","offer_id":64390059884913,"sku":"DK1202275","price":10.75,"currency_code":"USD","in_stock":true},{"title":"Painted Canyon \/ OS","offer_id":64390059917681,"sku":"DK1202276","price":8.75,"currency_code":"USD","in_stock":true},{"title":"Poppy Iceberg \/ OS","offer_id":64390059950449,"sku":"DK1202277","price":11.25,"currency_code":"USD","in_stock":true},{"title":"Molten Lava \/ OS","offer_id":64390059983217,"sku":"DK1202278","price":10.25,"currency_code":"USD","in_stock":true},{"title":"Bison \/ OS","offer_id":64390060015985,"sku":"DK1202279","price":9.25,"currency_code":"USD","in_stock":true},{"title":"Deep Blue \/ OS","offer_id":64390060048753,"sku":"DK1202280","price":8.75,"currency_code":"USD","in_stock":true},{"title":"Deep Lake \/ OS","offer_id":64390060081521,"sku":"DK1202281","price":11.25,"currency_code":"USD","in_stock":true},{"title":"Sand Quartz \/ OS","offer_id":64390060114289,"sku":"DK1202282","price":10.0,"currency_code":"USD","in_stock":true},{"title":"Street Art \/ OS","offer_id":64390060147057,"sku":"DK1202283","price":9.25,"currency_code":"USD","in_stock":true},{"title":"Steel Grey \/ OS","offer_id":64390060179825,"sku":"DK1202284","price":11.25,"currency_code":"USD","in_stock":true},{"title":"Woodland Floral \/ OS","offer_id":64390060212593,"sku":"DK1202285","price":10.25,"currency_code":"USD","in_stock":true},{"title":"Black \/ OS","offer_id":64390060245361,"sku":"DK1202286","price":8.75,"currency_code":"USD","in_stock":true},{"title":"Red Earth \/ OS","offer_id":64390060278129,"sku":"DK1202287","price":10.0,"currency_code":"USD","in_stock":true},{"title":"Solstice Floral \/ OS","offer_id":64390060310897,"sku":"DK1202288","price":9.75,"currency_code":"USD","in_stock":true},{"title":"Blue Graphite \/ OS","offer_id":64390060343665,"sku":"DK1202289","price":11.25,"currency_code":"USD","in_stock":true},{"title":"Cascade Camo \/ OS","offer_id":64390060376433,"sku":"DK1202290","price":10.0,"currency_code":"USD","in_stock":true},{"title":"Port Red \/ OS","offer_id":64390060409201,"sku":"DK1202291","price":10.5,"currency_code":"USD","in_stock":true},{"title":"Sparrow \/ OS","offer_id":64390060441969,"sku":"DK1202292","price":10.5,"currency_code":"USD","in_stock":true},{"title":"Sun Flare \/ OS","offer_id":64390060474737,"sku":"DK1202293","price":9.25,"currency_code":"USD","in_stock":true},{"title":"B4BC Floral \/ OS","offer_id":64390060507505,"sku":"DK1202294","price":10.75,"currency_code":"USD","in_stock":true},{"title":"Olive Ashcroft Camo \/ OS","offer_id":64390060540273,"sku":"DK1202295","price":8.75,"currency_code":"USD","in_stock":true},{"title":"Shadow Dash \/ OS","offer_id":64390060573041,"sku":"DK1202296","price":11.0,"currency_code":"USD","in_stock":true},{"title":"Greyscale \/ OS","offer_id":64390060605809,"sku":"DK1202297","price":10.25,"currency_code":"USD","in_stock":true},{"title":"Caramel \/ OS","offer_id":64390060638577,"sku":"DK1202298","price":9.5,"currency_code":"USD","in_stock":true},{"title":"Dark Olive \/ Dark Rose \/ OS","offer_id":64390060671345,"sku":"DK1202299","price":9.5,"currency_code":"USD","in_stock":true},{"title":"Deep Red \/ OS","offer_id":64390060704113,"sku":"DK1202300","price":10.5,"currency_code":"USD","in_stock":true},{"title":"Begonia \/ OS","offer_id":64390060736881,"sku":"DK1202301","price":9.0,"currency_code":"USD","in_stock":true},{"title":"Dark Slate \/ OS","offer_id":64390060769649,"sku":"DK1202302","price":9.75,"currency_code":"USD","in_stock":true},{"title":"Rincon \/ OS","offer_id":64390060802417,"sku":"DK1202303","price":10.5,"currency_code":"USD","in_stock":true},{"title":"Black - W22 \/ OS","offer_id":64390060835185,"sku":"DK1202304","price":9.25,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/GOGGLESTASH-BLUEGRAPHITE-194626410159_10002159_BLUEGRAPHI-22M_MAIN.jpg?v=1786437322"},{"product_id":"daily-carry-essential-goggle-case-for-snow-sports-equipment-transport-protection-and-winter-use-1052","title":"Daily Carry Essential Goggle Case for Snow Sports Equipment Transport Protection and Winter Use","description":"Goggle Case is intended for snow sports equipment transport protection and winter use.\u003ch3\u003eExtra Storage for designed for consistency Visibility\u003c\/h3\u003e\nGoggle Case is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eLet’s face it. Goggle lenses fog. They get scratched. They get dirty. Light changes throughout the day. But with the right gear, you can be prepared for any situation the mountain can throw at you. Our Goggle Case stores two extra pairs of goggles and 2 extra lenses and comes with a removable goggle wipe and 360-degree foam padding for protection. Don’t let winter catch you off guard. Come prepared and stay out longer.\u003c\/p\u003e\nGoggle Case is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Case is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Case is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e600D Polyester with water repellent finish \/Bluesign® approved materials\u003c\/li\u003e\nGoggle Case is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nGoggle Case is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Case is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Case is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eOne Size\u003c\/li\u003e\nGoggle Case is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nGoggle Case is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Case is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nGoggle Case is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Case is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eStores 2pr Goggles + 2 pairs of extra lenses\u003c\/li\u003e\nGoggle Case is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRemovable goggle wipe included\u003c\/li\u003e\nGoggle Case is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e360deg foam padded protection\u003c\/li\u003e\nGoggle Case is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eGoggle Case is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Vintage Camo \/ OS","offer_id":64390213140849,"sku":"DK1204677","price":14.0,"currency_code":"USD","in_stock":true},{"title":"Steel Grey \/ OS","offer_id":64390213173617,"sku":"DK1204678","price":15.2,"currency_code":"USD","in_stock":true},{"title":"Deep Lake \/ OS","offer_id":64390213206385,"sku":"DK1204679","price":15.6,"currency_code":"USD","in_stock":true},{"title":"Cascade Camo \/ OS","offer_id":64390213239153,"sku":"DK1204680","price":14.8,"currency_code":"USD","in_stock":true},{"title":"Black \/ OS","offer_id":64390213271921,"sku":"DK1204681","price":18.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/GOGGLECASE-DEEPLAKE-194626473796_10003827_DEEPLAKE-32M_MAIN.jpg?v=1786437585"},{"product_id":"organized-outdoor-use-goggle-case-rubber-for-snow-sports-equipment-transport-protection-and-winter-use-1169","title":"Organized Outdoor Use Goggle Case - Rubber for Snow Sports Equipment Transport Protection and Winter Use","description":"Goggle Case - Rubber is intended for snow sports equipment transport protection and winter use.\u003ch3\u003eExtra Storage for designed for consistency Visibility\u003c\/h3\u003e\nGoggle Case - Rubber is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eLet’s face it. Goggle lenses fog. They get scratched. They get dirty. Light changes throughout the day. But with the right gear, you can be prepared for any situation the mountain can throw at you. Our Goggle Case stores two extra pairs of goggles and 2 extra lenses and comes with a removable goggle wipe and 360-degree foam padding for protection. Don’t let winter catch you off guard. Come prepared and stay out longer.\u003c\/p\u003e\nGoggle Case - Rubber is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Case - Rubber is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Case - Rubber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eBODY: fully RECYCLED POLYESTER\u003c\/li\u003e\nGoggle Case - Rubber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLINING: fully POLYESTER\u003c\/li\u003e\nGoggle Case - Rubber is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nGoggle Case - Rubber is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Case - Rubber is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Case - Rubber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e10.62 x 10.23 x 5.51in [ 27 x 26 x 14cm ]\u003c\/li\u003e\nGoggle Case - Rubber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e0.62 lbs [ 0.28 kgs ]\u003c\/li\u003e\nGoggle Case - Rubber is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nGoggle Case - Rubber is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Case - Rubber is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nGoggle Case - Rubber is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Case - Rubber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eStores 2 pairs of goggles and 2 extra lenses\u003c\/li\u003e\nGoggle Case - Rubber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e360° padded foam protection\u003c\/li\u003e\nGoggle Case - Rubber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRemovable goggle wipe included\u003c\/li\u003e\nGoggle Case - Rubber is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully recycled polyester\u003c\/li\u003e\nGoggle Case - Rubber is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eGoggle Case - Rubber is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Rubber \/ OS","offer_id":64390334513521,"sku":"DK1205185","price":16.8,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/GOGGLECASE-RUBBER-194626560540_10004392_RUBBER-52M_MAIN.jpg?v=1786437838"},{"product_id":"active-equipment-goggle-stash-navy-for-snow-sports-equipment-transport-protection-and-winter-use-1183","title":"Active Equipment Goggle Stash - Navy for Snow Sports Equipment Transport Protection and Winter Use","description":"Goggle Stash - Navy is intended for snow sports equipment transport protection and winter use.\u003ch3\u003eA padded goggle case with extra storage\u003c\/h3\u003e\nGoggle Stash - Navy is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eClean, dry goggles make for great riding. Give your goggles the respect they deserve between days at the hill with this goggle case. It's big enough to handle large frameless styles and features a built-in pouch to add moisture-absorbing desiccant pouches to expedite drying after a day of storm riding.\u003c\/p\u003e\nGoggle Stash - Navy is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Stash - Navy is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Stash - Navy is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eBODY: fully RECYCLED POLYESTER\u003c\/li\u003e\nGoggle Stash - Navy is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLINING: fully POLYESTER\u003c\/li\u003e\nGoggle Stash - Navy is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nGoggle Stash - Navy is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Stash - Navy is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Stash - Navy is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e9.44 x 6.69 x 4.72in [ 24 x 17 x 12cm ]\u003c\/li\u003e\nGoggle Stash - Navy is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e0.55 lbs [ 0.25 kgs ]\u003c\/li\u003e\nGoggle Stash - Navy is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nGoggle Stash - Navy is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Stash - Navy is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nGoggle Stash - Navy is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Stash - Navy is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eStores 1 pair of goggles and 2 extra lenses\u003c\/li\u003e\nGoggle Stash - Navy is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e360° padded foam protection\u003c\/li\u003e\nGoggle Stash - Navy is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRemovable goggle wipe included\u003c\/li\u003e\nGoggle Stash - Navy is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully recycled polyester\u003c\/li\u003e\nGoggle Stash - Navy is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eGoggle Stash - Navy is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Naval Academy \/ OS","offer_id":64390343000433,"sku":"DK1205211","price":9.25,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/GOGGLESTASH-NAVALACADEMY-194626559926_10004393_NVLACADEMY-52M_MAIN.jpg?v=1786437871"},{"product_id":"organized-outdoor-use-goggle-case-wildflower-for-snow-sports-equipment-transport-protection-and-winter-use-1184","title":"Organized Outdoor Use Goggle Case - Wildflower for Snow Sports Equipment Transport Protection and Winter Use","description":"Goggle Case - Wildflower is intended for snow sports equipment transport protection and winter use.\u003ch3\u003eExtra Storage for designed for consistency Visibility\u003c\/h3\u003e\nGoggle Case - Wildflower is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eLet’s face it. Goggle lenses fog. They get scratched. They get dirty. Light changes throughout the day. But with the right gear, you can be prepared for any situation the mountain can throw at you. Our Goggle Case stores two extra pairs of goggles and 2 extra lenses and comes with a removable goggle wipe and 360-degree foam padding for protection. Don’t let winter catch you off guard. Come prepared and stay out longer.\u003c\/p\u003e\nGoggle Case - Wildflower is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Case - Wildflower is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Case - Wildflower is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eBODY: fully RECYCLED POLYESTER\u003c\/li\u003e\nGoggle Case - Wildflower is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLINING: fully POLYESTER\u003c\/li\u003e\nGoggle Case - Wildflower is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nGoggle Case - Wildflower is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Case - Wildflower is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Case - Wildflower is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e10.62 x 10.23 x 5.51in [ 27 x 26 x 14cm ]\u003c\/li\u003e\nGoggle Case - Wildflower is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e0.62 lbs [ 0.28 kgs ]\u003c\/li\u003e\nGoggle Case - Wildflower is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nGoggle Case - Wildflower is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Case - Wildflower is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nGoggle Case - Wildflower is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Case - Wildflower is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eStores 2 pairs of goggles and 2 extra lenses\u003c\/li\u003e\nGoggle Case - Wildflower is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e360° padded foam protection\u003c\/li\u003e\nGoggle Case - Wildflower is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRemovable goggle wipe included\u003c\/li\u003e\nGoggle Case - Wildflower is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully recycled polyester\u003c\/li\u003e\nGoggle Case - Wildflower is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eGoggle Case - Wildflower is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Wildflower \/ OS","offer_id":64390344311153,"sku":"DK1205212","price":16.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/GOGGLECASE-WILDFLOWER-194626560199_10004392_WILDFLOWER-52M_MAIN.jpg?v=1786437873"},{"product_id":"outdoor-adventure-goggle-case-navy-for-snow-sports-equipment-transport-protection-and-winter-use-1185","title":"Outdoor Adventure Goggle Case - Navy for Snow Sports Equipment Transport Protection and Winter Use","description":"Goggle Case - Navy is intended for snow sports equipment transport protection and winter use.\u003ch3\u003eExtra Storage for designed for consistency Visibility\u003c\/h3\u003e\nGoggle Case - Navy is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eLet’s face it. Goggle lenses fog. They get scratched. They get dirty. Light changes throughout the day. But with the right gear, you can be prepared for any situation the mountain can throw at you. Our Goggle Case stores two extra pairs of goggles and 2 extra lenses and comes with a removable goggle wipe and 360-degree foam padding for protection. Don’t let winter catch you off guard. Come prepared and stay out longer.\u003c\/p\u003e\nGoggle Case - Navy is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Case - Navy is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Case - Navy is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eBODY: fully RECYCLED POLYESTER\u003c\/li\u003e\nGoggle Case - Navy is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLINING: fully POLYESTER\u003c\/li\u003e\nGoggle Case - Navy is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nGoggle Case - Navy is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Case - Navy is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Case - Navy is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e10.62 x 10.23 x 5.51in [ 27 x 26 x 14cm ]\u003c\/li\u003e\nGoggle Case - Navy is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e0.62 lbs [ 0.28 kgs ]\u003c\/li\u003e\nGoggle Case - Navy is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nGoggle Case - Navy is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Case - Navy is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nGoggle Case - Navy is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Case - Navy is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eStores 2 pairs of goggles and 2 extra lenses\u003c\/li\u003e\nGoggle Case - Navy is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e360° padded foam protection\u003c\/li\u003e\nGoggle Case - Navy is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRemovable goggle wipe included\u003c\/li\u003e\nGoggle Case - Navy is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully recycled polyester\u003c\/li\u003e\nGoggle Case - Navy is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eGoggle Case - Navy is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Naval Academy \/ OS","offer_id":64390346146161,"sku":"DK1205213","price":15.2,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/GOGGLECASE-NAVALACADEMY-194626559001_10004392_NVLACADEMY-52M_MAIN.jpg?v=1786437875"},{"product_id":"travel-ready-gear-goggle-case-black-for-snow-sports-equipment-transport-protection-and-winter-use-1186","title":"Travel Ready Gear Goggle Case - Black for Snow Sports Equipment Transport Protection and Winter Use","description":"Goggle Case - Black is intended for snow sports equipment transport protection and winter use.\u003ch3\u003eExtra Storage for designed for consistency Visibility\u003c\/h3\u003e\nGoggle Case - Black is intended for snow sports equipment transport protection and winter use.\n\u003cp\u003eLet’s face it. Goggle lenses fog. They get scratched. They get dirty. Light changes throughout the day. But with the right gear, you can be prepared for any situation the mountain can throw at you. Our Goggle Case stores two extra pairs of goggles and 2 extra lenses and comes with a removable goggle wipe and 360-degree foam padding for protection. Don’t let winter catch you off guard. Come prepared and stay out longer.\u003c\/p\u003e\nGoggle Case - Black is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Case - Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Case - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eBODY: fully RECYCLED POLYESTER\u003c\/li\u003e\nGoggle Case - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eLINING: fully POLYESTER\u003c\/li\u003e\nGoggle Case - Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nGoggle Case - Black is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Case - Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Case - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e10.62 x 10.23 x 5.51in [ 27 x 26 x 14cm ]\u003c\/li\u003e\nGoggle Case - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e0.62 lbs [ 0.28 kgs ]\u003c\/li\u003e\nGoggle Case - Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003e\nGoggle Case - Black is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003esplit\u003c\/h6\u003e\nGoggle Case - Black is intended for snow sports equipment transport protection and winter use.\n\u003ch6\u003eFeatures\u003c\/h6\u003e\nGoggle Case - Black is intended for snow sports equipment transport protection and winter use.\n\u003cul\u003e\nGoggle Case - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eStores 2 pairs of goggles and 2 extra lenses\u003c\/li\u003e\nGoggle Case - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003e360° padded foam protection\u003c\/li\u003e\nGoggle Case - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003eRemovable goggle wipe included\u003c\/li\u003e\nGoggle Case - Black is intended for snow sports equipment transport protection and winter use.\n\u003cli\u003efully recycled polyester\u003c\/li\u003e\nGoggle Case - Black is intended for snow sports equipment transport protection and winter use.\n\u003c\/ul\u003eGoggle Case - Black is intended for snow sports equipment transport protection and winter use.","brand":"Dakine Equipment","offers":[{"title":"Black \/ OS","offer_id":64390346441073,"sku":"DK1205214","price":19.2,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/1032\/5288\/5873\/files\/GOGGLECASE-BLACK-194626558745_10004392_BLACK-52M_MAIN.jpg?v=1786437877"}],"url":"https:\/\/dakineuds.it.com\/collections\/snow-goggles-and-lenses.oembed?page=2","provider":"Markus Galmore Store","version":"1.0","type":"link"}